DPCstruct | MC5678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | PF00571- CL0436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2IXS6 | 18-163 | DVINKQLLIFLEAKNYEAAKTLLIPVASVDIAEAIADLPKTMQIIAFRLLNKQEAIEVYKYLDKATQQSLIEDFKDTEAVEIINNMS… |
| A0A6G9YRH4 | 330-491 | ARLRGLKPAQIADLLEDADKHERGEILDQVHGDPELEADVFEELDSDESSRLLNDMPDDEVAALLGRMRADDAADSIMELRQSRRRR… |
| A0A7C5I4Q5 | 2-144 | None |
| D6PE45 | 6-147 | None |
| A0A6J6NSP4 | 21-171 | None |
| A0A820TIG4 | 178-343 | None |
| A0A2Z5QLG0 | 171-307 | None |
| A0A535RZ74 | 3-182 | None |
| A0A7R8WR58 | 257-407 | None |
| A0A7X1GMK4 | 275-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.