DPCstruct | MC55685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 596 |
|---|---|
| Mean domain length (aa) | 156 ± 31 aa |
| Standard deviation of domain lengths | 31.02 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 14.74 |
| Pfam Score | 94.01 |
| Assigned Pfam label(s) | CL0489- CL0039- CL0010- CL0229- PF01448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A8E1U9 | 25-206 | DASPDARPTASAVVGVPAFQWLGRGKRRGGVTEYRGFRADTHFVALGDVVMLDPGPGESEPFVGWVTRLFEASDGQMMMRAQWFFRK… |
| A0A830B7Y0 | 7-120 | GKKDLDSYTIKGTNKVVRPGDCVLMRPSDTDKPPYVACVEKIEADHRNNAKVRVRWYYRPEESIGGRRQFHGAKELFLSNHFDIQSA… |
| A0A0C2M1M6 | 1-195 | None |
| A0A068UM41 | 71-239 | None |
| A0A4Z2HG55 | 873-1041 | None |
| A0A1A7Y1F1 | 995-1158 | None |
| A0A2G8L7C6 | 53-194 | None |
| A0A2G8LJQ7 | 2-118 | None |
| A0A068UPH6 | 22-154 | None |
| A0A0D8XGD2 | 41-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.