DPCstruct | MC4961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 226 |
|---|---|
| Mean domain length (aa) | 225 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.15 |
| Pfam Score | 99.49 |
| Assigned Pfam label(s) | PF06695- PF09335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8WVI6 | 3-153 | ELMPLIKWEMATFSTPMLAVLIFASVALFPTIFLPSSPSMWVAGMAFGYGFGFLLIISAAAVGVSLPFFIGSLFLHRIRGWLEKYPK… |
| I4C8Q1 | 6-229 | ILVLLLVGLVAGIIIWGVSLPSVRQHMLTVLQWIQELGPWGPFFVTLFYIAACVFLLPGSVLTLAAGFLFGVPIGFLSAWLGATLGA… |
| A0A812NW18 | 339-581 | None |
| R6GQW3 | 34-269 | None |
| A0A0B9AQV1 | 1-211 | None |
| Q1NVU6 | 7-234 | None |
| A0A7R8H8Z7 | 40-240 | None |
| A0A6U4KZU7 | 34-228 | None |
| A0A842UYQ1 | 5-210 | None |
| A0A1Y3WBJ7 | 392-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.