DPCstruct | MC4469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 920 |
|---|---|
| Mean domain length (aa) | 145 ± 32 aa |
| Standard deviation of domain lengths | 32.36 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.16 |
| Pfam Score | 93.65 |
| Assigned Pfam label(s) | PF10615- CL0273- CL0063- CL0336- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9SLZ6 | 30-159 | DRAELLDAARLTINSARYAALISLDHTGQPRSRTVDAFPPDENFVVWVATRPVTRKVEQIRNNPKVTLYYWHAETRSYVSIMGMATI… |
| H3KE64 | 28-173 | REMTPKEALELLRRTPNAVMATADGEGRPYGVPVTVAFVEGVFYVHGTSAGGRRSSNLTENPFASLTFVVEGGWDAEPYSLFYASVI… |
| A0A558CTL0 | 9-150 | None |
| A0A542P3L4 | 29-164 | None |
| A0A0G4HNA5 | 24-191 | None |
| A0A7K2Y5X3 | 139-265 | None |
| A0A7S5P6L2 | 231-374 | None |
| A0A535A3E8 | 5-157 | None |
| A0A2I0NEN6 | 108-252 | None |
| A0A1H4DPW9 | 157-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.