DPCstruct | MC43894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.04 |
| Pfam Score | 89.63 |
| Assigned Pfam label(s) | PF14374- PF00557- PF00573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821MR62 | 2-84 | QACSCIWTESAFRKSDGLYGTWRKAAFPKSNHNLPMHKVTNTDLNRILKSPESQRALRAPRKKIQRRVLKKNLRKSPRITLKL |
| S7MLR6 | 58-133 | TESAFRKLDELYGTWRRAASLKSNYNLPMHKMLNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKL |
| A0A7S2CUV3 | 43-113 | None |
| A0A7S0DI18 | 25-108 | None |
| A0A812N881 | 252-330 | None |
| A0A2I3TF82 | 213-279 | None |
| A0A2B4SSK7 | 410-485 | None |
| A0A4Y7KUV0 | 77-162 | None |
| A0A251RTF6 | 57-132 | None |
| F6HC63 | 118-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.