DPCstruct | MC40443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 652 |
|---|---|
| Mean domain length (aa) | 205 ± 52 aa |
| Standard deviation of domain lengths | 51.81 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 11.17 |
| Pfam Score | 76.48 |
| Assigned Pfam label(s) | CL0023- PF16322- CL0063- CL0395- PF20236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0A9C0 | 87-291 | TGKRNNSQRPSNNSKEIVPGVDLSDNQYTLKQRLLFNRYKLYDQDGGLVMKAKQKILKMKEDFRFKNSDDEEVMHVKAENIMDVAGD… |
| A0A2S0L0M1 | 114-264 | ITFYYDAAGYLTGSAAETDGAVVRRNAAGTVIGTELIEGGKTLYYDGSGNLTGARVVSGGTALVYNAAGEVYSREVTTGELTTYYNA… |
| A0A1E7FSM0 | 36-222 | None |
| A0A0S6X9K4 | 33-257 | None |
| A0A369JU63 | 21-282 | None |
| A0A1Y1V1G6 | 11-188 | None |
| A0A0C9ME37 | 3-154 | None |
| A0A0S6X8K6 | 13-171 | None |
| G0RRD3 | 28-262 | None |
| M9LIX7 | 103-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.