DPCstruct | MC35555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 245 ± 45 aa |
| Standard deviation of domain lengths | 45.13 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.53 |
| Pfam Score | 60.42 |
| Assigned Pfam label(s) | PF00253- PF07850- PF20520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8RMG8 | 20-262 | TVSAHSSSAMAPAFIWSNLRCVDSGQQVNYQVSDARSVTRAALEQLDMKKCLDESEKPADLLVAFVGSEVRSVELSNELSSYTVEKL… |
| A0A553R9D1 | 12-216 | SFCGCFAQVPLLMWTSYGSSMPHQAGPAAGHRVTGAELQAYLKSAFSTAPRNVLLFLQEKLSVDDFTMFAGVFGNKQDSVFLSVESA… |
| A0A2K5Y706 | 1-259 | None |
| A0A7J7LYW6 | 7-268 | None |
| A0A556TU15 | 14-239 | None |
| A0A7N0RIZ5 | 23-322 | None |
| A0A090LQ80 | 174-496 | None |
| A0A059B1X8 | 1-289 | None |
| A0A0S6XS14 | 16-261 | None |
| A0A5B7FFY8 | 2-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.