DPCstruct | MC35181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 350 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 94.11 |
| Assigned Pfam label(s) | PF19418- CL0029- CL0123- PF01151- PF12316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519UJG7 | 7-101 | QDILGIAALMRRHIEIRNRSWLKRVHRDSFVGSEAVDFLVTQGFADTRKAAVELGVKMHNKKLIRNLSDSRKFSDSLHYYRFAEDDH… |
| U9VVY4 | 70-152 | LEQLVTQMRSSSAGISIKDRRYKLKVYPKCFIGNEAVDWLINNANLTPHEAIRVGQRMLERHIIHHVLDEQDFENNHFFYRFY |
| A0A2G8L0B8 | 54-159 | None |
| A0A182FG44 | 7-100 | None |
| A0A4Z2HQR7 | 19-135 | None |
| A0A1V2LHK0 | 580-683 | None |
| A0A7S0MER4 | 32-139 | None |
| A0A7R9KYG9 | 33-141 | None |
| A0A7S4NP35 | 85-185 | None |
| A0A819RE18 | 4-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.