DPCstruct | MC33911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 718 |
|---|---|
| Mean domain length (aa) | 160 ± 26 aa |
| Standard deviation of domain lengths | 25.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.43 |
| Pfam Score | 96.24 |
| Assigned Pfam label(s) | CL0126- CL0345- PF03945- CL0056- PF13963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2E099 | 4-119 | YTVISEGGSGGNGFEMQSIKSIGLRSGKYVDQITINGVSHGENGGADRGTLTLEDGEYVTSIVVRSGSLIDYVEFNTNFNNQIKGGG… |
| A0A6A4DIC5 | 40-192 | YAERASTLFGTTAGRPFTHDKVPPFGSISDVAVICGKKVDGISQVVKTHGHVSSEGILHGNPFGNREVFSLAKGEKLVTVEGFASHS… |
| A0A2E2SG73 | 261-417 | None |
| A0A318YJP5 | 406-550 | None |
| A0A559QVJ5 | 134-337 | None |
| A0A2N9IFE7 | 9-250 | None |
| A0A1Y2HC70 | 2-192 | None |
| A0A1Y2HMM6 | 2-244 | None |
| A0A820ALR9 | 1-124 | None |
| A0A803PV63 | 275-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.