DPCstruct | MC32536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 533 |
|---|---|
| Mean domain length (aa) | 301 ± 48 aa |
| Standard deviation of domain lengths | 48.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.61 |
| Pfam Score | 71.18 |
| Assigned Pfam label(s) | PF00057- CL0220- CL0124- CL0293- PF21109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0R2H3 | 4-309 | QIGITMDLLKLEYKQNIFDFTCSKTTYTLDGNNRLADGISYKPLLLMDQQNKTFMAQNQQEFEEIKIQTTRTIIENKEYMEELKKVV… |
| A0A2H0Q7V9 | 22-321 | SNIGKGISSFDQNAGLKDRCINLTQEEVFSEDVRATSYSLLLVKNKEELYDKISTSVSAEGSYGVFGAKAKASFVKEIKWNYNSNYI… |
| A0A818ZBJ1 | 254-607 | None |
| A0A7R9A8S9 | 23-347 | None |
| A0A2N0DY66 | 103-387 | None |
| A0A117VJD3 | 314-650 | None |
| A0A7R8X3W7 | 4-292 | None |
| A0A2I1DSQ6 | 693-935 | None |
| A0A226EVK8 | 378-687 | None |
| A0A6A5Y5S9 | 99-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.