DPCstruct | MC28708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 234 ± 30 aa |
| Standard deviation of domain lengths | 30.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9L384 | 186-412 | GPDEQLQGPGGGDSAGGTYQQLTLNLFLSETEQIQNIDEAENVKASSAFSFAQKDIDLVLRLGGNTDRLRERVTAAFEKQKPIPEIA… |
| A0A174HW10 | 1-209 | MTKTGSILPEETLNAILRTGSNHNRTELRLIYNFMSVQTKEEYEEFVRNEYGNGGKGFIIDGKKYAVWFNKNGMQIALGETVRTKDK… |
| A0A373A6H5 | 6-179 | None |
| A0A1M6T962 | 384-675 | None |
| A0A7X3SIF0 | 1-254 | None |
| A0A3D2Q120 | 2-207 | None |
| A0A1Y4NIQ9 | 6-237 | None |
| F9P9A5 | 4-213 | None |
| F9P862 | 7-205 | None |
| A0A396QFE4 | 4-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.