DPCstruct | MC275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 134 ± 26 aa |
| Standard deviation of domain lengths | 26.24 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.53 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | CL0003- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834E6J9 | 331-479 | KFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMREEDVEKLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLM… |
| A0A645H219 | 13-157 | TLDGANVEIAEQVGDDNIYIFGMRVEKVNTLYQEGSYSPIGIYEQNAELRRALTQMIDGTLFPDNPALLQGLYHDLLFGSWGAPADP… |
| A0A0K6G366 | 91-237 | None |
| A0A2G6JNW2 | 2-114 | None |
| A0A6I9XT20 | 9-129 | None |
| A0A817UP40 | 215-345 | None |
| A0A0M3JM74 | 1-87 | None |
| G9ZFE4 | 14-152 | None |
| A0A2G9UX62 | 455-560 | None |
| A0A1A9VZ66 | 67-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.