DPCstruct | MC24315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 291 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 93.99 |
| Assigned Pfam label(s) | PF00095- CL0220- PF09307- CL0620- CL0005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P84032 | 59-124 | STKVKECGCYLKQKERKDSGRESAIIPQCEEDGKWAKKQLWEFNKSCWCVDEKGEQVGKIHHDCDS |
| A0A3Q3AA04 | 12-92 | TGLNEPERPKTRCEHHRDSVQTTSPDGLPLLGAYVPQCDEHGQYQSQQCHGSTGYCWCVDSRGQERPGTRTSPGAPRADCS |
| C3ZZ07 | 6-102 | None |
| A0A4P9D0M8 | 113-199 | None |
| A0A2D4KHH5 | 32-126 | None |
| A0A7E4W957 | 63-174 | None |
| C3ZFN0 | 57-146 | None |
| H3B8G7 | 195-276 | None |
| A0A182TJ71 | 171-245 | None |
| A0A7M5X4U3 | 673-754 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.