DPCstruct | MC21957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G7TNU1 | 235-363 | TKGVHSGRMYNPEKIGGLIQNLDWTAVTVTQNGINLVKLHTRRFPPSDANKIMTSRLERILRGEIPITDIDKRFYTHEIRELERYRA… |
| A0A7Z9BZF2 | 1-112 | MFGKLEGQEFIVEQEKLEMIKQHIADNFYDYHPNKMMIKRLELALNGHKKISGADASFYFHELREAELMEQGLIYNEAHKQALKDYE… |
| A0A2S9IFL2 | 261-387 | None |
| A0A4R6QCM5 | 56-193 | None |
| A0A2S9I8T6 | 15-128 | None |
| A0A383R5I4 | 68-211 | None |
| A0A7U6J2J0 | 403-520 | None |
| U5QQ64 | 124-239 | None |
| A0A5J6MG68 | 731-839 | None |
| A0A3R7VQW7 | 470-605 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.