DPCstruct | MC21954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 420 |
|---|---|
| Mean domain length (aa) | 214 ± 46 aa |
| Standard deviation of domain lengths | 45.76 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 99.13 |
| Assigned Pfam label(s) | CL0125- PF20108- CL0716- CL0366- PF05634 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0EPG3 | 1-139 | FNPAVTLGLWAGGRFPAKDIIGYVVAQVVGGIIAAAILYVIASGKAGFDATASGFASNGFGEHSPGGFSMLSAIVIEIVLTAGFLLV… |
| J3FRV8 | 12-228 | LGTFWLVLGGCGSAVIAASSPLGIGVLGVALAFGLTVLTMAFAIGHISGCHLNPAVSVGLFVGGRFPAKELPAYIIAQVLGAILAAA… |
| A0A843X586 | 98-271 | None |
| A0A7J6PYS9 | 6-151 | None |
| A0A446PIY5 | 24-152 | None |
| A0A5P1F9G6 | 5-181 | None |
| A0A4S4DAX3 | 241-458 | None |
| A0A2C9JL65 | 2-116 | None |
| A0A813BUL8 | 25-242 | None |
| A0A150NT78 | 8-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.