DPCstruct | MC19890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 189 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 20.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.29 |
| Pfam Score | 93.37 |
| Assigned Pfam label(s) | PF02470- PF02405- PF11887 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6TNF2 | 3-109 | NGYKIKARFDNIGGLKVKAAVTMAGVRIGRVSDITFDTGKYQAVVTMDVDGRYKTLPTDTSATILTAGLLGEQYVGLEPGAEEEYLK… |
| D0X0W9 | 9-130 | VKSIHDAGQRVQIYFSDAAGLVAGRTTIRYQGLEVGMVRDINLTEDLGSIYVDADIYPEAAKLLNDKTRFWLVKPTASLTGVSGLDA… |
| A0A0S6W578 | 28-142 | None |
| M1PHR4 | 154-273 | None |
| A0A7D5MYA9 | 13-191 | None |
| A0A3E1E8G9 | 17-159 | None |
| A0A2N9YA63 | 58-163 | None |
| A0A1A9VJV1 | 128-239 | None |
| A0A4R1IFA7 | 54-157 | None |
| A0A4U9HCJ7 | 22-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.