DPCstruct | MC19315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZMG3 | 387-464 | DANLLLDDGGDLTQIIHNEYPQMLKTIHGISEETTTGVHRLLEMMREDQLKVPAINVNDAITKSKNDNRYGCRHSLND |
| A0A7J7KA91 | 2-66 | ILDDGGDLTNLVHEKYPQYIDGIKGLSEETTTGVHNLYKMLKNGTLKIPAVNVNDSVTKVRHAQA |
| A0A853D149 | 246-308 | None |
| A0A7R9LY95 | 1-75 | None |
| R9P3J3 | 124-198 | None |
| A0A3Q0JFI5 | 447-521 | None |
| A0A821VTC9 | 10-76 | None |
| A0A6A5D7B0 | 241-318 | None |
| A0A1W0XBE7 | 564-640 | None |
| A0A2C6MAM1 | 207-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.