DPCstruct | MC17772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 146 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.85 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | PF14449- CL0695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K4IER9 | 29-160 | RGTKFKPEVVYSFIHASIGRIKNGNVTGVHFYNPERVWIIKILKTNETNKTFLADFEFYDIDNKKWIHKKTPSSFFPADWNIATLLM… |
| A0A2V3W6W4 | 35-175 | EINEVTAITDLEHTEYFRNLALEHILEGEINKKGAAVGFHYDRLPTKKGEVIEGTETKPNELGVYEAEVVVNHVEKTSNGGKSTFFP… |
| A0A8B2DGZ1 | 5-123 | None |
| A0A0Q5GLU2 | 78-247 | None |
| J8HPU4 | 2-102 | None |
| A0A7H1N2B1 | 5-157 | None |
| A0A1V5R3R0 | 809-934 | None |
| A0A850KCU3 | 17-149 | None |
| A0A2S0UEB1 | 615-762 | None |
| W7DCI7 | 62-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.