DPCstruct | MC13540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 191 |
|---|---|
| Mean domain length (aa) | 212 ± 33 aa |
| Standard deviation of domain lengths | 33.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 68.35 |
| Assigned Pfam label(s) | PF04998- PF04992- PF04983- PF00623- PF05000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835VFK8 | 2-227 | DYLLFFLRDYNVFAAASCMNRLAKLSARWIGNHGFSIGIDDVQPGERLNQQKKRTIDDGNRECREFITKYNKAELTLQTGCDAAQTL… |
| A0A833E2T6 | 2-154 | VLSAARKKVEDIVVNYLDPFNNVFIMARTGARGNELNITQMAALLGQQSVRGERIYRGYRDRYLPHFRSGDLGAAARGFVYSSFYEG… |
| A0A843E157 | 280-526 | None |
| F3KFL6 | 5-216 | None |
| A0A835R4S9 | 608-824 | None |
| A0A6A4GUT0 | 43-281 | None |
| T1GNZ5 | 299-511 | None |
| T1H0L1 | 3-163 | None |
| A0A662MCS6 | 877-1119 | None |
| A0A2H2IYM4 | 386-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.