DPCstruct | MC13002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 227 |
|---|---|
| Mean domain length (aa) | 239 ± 43 aa |
| Standard deviation of domain lengths | 42.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 97.15 |
| Assigned Pfam label(s) | CL0039- CL0292- CL0344- PF14715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413PYB6 | 55-274 | YARHFVQLAVGSYMLLYLGIISCENMQIEGFWYYLFLGVFEAATIHYAVAKIFGPLLFGRGWCGYACWTAMVLDFLPYKQPKKPRKE… |
| A0A661NG14 | 18-264 | MLVAIPLLSMARIDFIQGTLCSFGTESWSVSCPLGVAQTSLASRTLDAGLLLSGFAFIALAFVAGRVFCSWICPQGFFSELGDKVHL… |
| G8QU82 | 12-269 | None |
| A0A2H0P676 | 142-433 | None |
| A0A7C0WYD3 | 56-308 | None |
| A0A2K2U493 | 4-309 | None |
| A0A7V3DYE6 | 2-151 | None |
| A0A2H0FPV6 | 6-313 | None |
| A0A3M1CYI2 | 92-340 | None |
| A0A661WVM5 | 337-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.