DPCstruct | MC12878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2B554 | 20-90 | SWHAEDIKSAIRKRGVTLAELCEQMGVDNRAASKALAEPFTKGELAIAQYLNVPVQLLFPTRWTADKKRVR |
| A0A6I6EC60 | 1-74 | MKKKTDMHPADIVAAIKKRQTSLAELSRRVGLSSGTLANALKRPWPKGEFIIAAALGMHPSEIWPSRYYDKRGR |
| A0A6S6S4B1 | 23-86 | None |
| A0A1C0U7H7 | 3-71 | None |
| A0A4Q5KRZ2 | 2-69 | None |
| A0A3S0B647 | 6-74 | None |
| A0A509JFQ2 | 130-211 | None |
| A0A7L5XUH6 | 16-97 | None |
| A0A1J0ETQ6 | 119-207 | None |
| A0A2U3THJ4 | 8-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.