DPCfam | MC235922
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 335 ± 21 aa |
| Residues in low-complexity regions (%) | 7.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00622- PF00622 |
| Sequences matching dominant architecture (%) | 86.67 |
| Average overlap percent | 73.79 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009731C87 | 1188-1526 | 339 | FLPVCTLGLSQVGRINLGQNVSSLRYFAICGLQEGFEPFAINMKRDITMWFSKSLPQFAPVPTAHQHIEVSRVDGTVDSAPCLKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QEE5-F1 | 229-298 | 20.00 | 92.19 | View in AlphaFoldDB ↗ |