DPCstruct | MC9997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 118 ± 21 aa |
| Standard deviation of domain lengths | 21.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6FQH6 | 8-153 | RKLKVLANADTPEDALAARNNGAEGIGLCRTEHMFFASDERIKAVRQMIMAPTVELRQQALDRLLPYQRSDFEGIFRAMDGLSVTIR… |
| A0A444CW77 | 276-373 | IMAANLEERQRALDLLLPYQRLDFEGIFRAMDGFPVTIRLLDPPLHEFLPEGNIEDIVAELASETGTSEDDVFSRIEKLSEVNPMLG… |
| A0A1D6FQF4 | 522-628 | None |
| A0A1M3ADZ4 | 451-554 | None |
| M1D507 | 142-248 | None |
| A0A812IPI0 | 137-243 | None |
| A0A845QJ20 | 387-491 | None |
| A0A2J7ZQF2 | 2-99 | None |
| A0A3A9B4U9 | 1-182 | None |
| A0A0B5I1G1 | 510-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.