DPCstruct | MC9994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 196 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0307 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PTV8 | 3-176 | FRSEIVDAAIHAAELLRVLGSDVSNMKHTLRTLTLLKSVHTSTYHLQHSMQLHSYILTPPQLHLLDLTKKPTTNTFSNTLYLGDHEH… |
| A0A444CP85 | 38-247 | AYEVMALYGCLRSEIQAPIELRVTFQTEILEATVEAAELLRCLANDLGNMKHSVRVSQLMRIRVSTDRLQRSVDLHSYLLTSHDGFP… |
| A0A540M0X1 | 2-187 | None |
| A0A835IXF1 | 346-502 | None |
| A0A426YVP7 | 183-364 | None |
| A0A6A6NKY2 | 273-514 | None |
| A0A287WB16 | 32-210 | None |
| A0A4S8JJ40 | 616-854 | None |
| M1A4J8 | 2-182 | None |
| A0A438EDH7 | 11-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.