DPCstruct | MC9991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 191 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4G7Q4 | 31-210 | RRIMSLDQILSAAASGDFAHYNPQHIIDAVNALLPLGKDAALAAIESYLDKRNLDIDPQEGLFLVLRVLFEVPTNPGYHLPMRLGGS… |
| A0A7X0DG85 | 30-258 | GGAMFVAVRTRTAMSSLLLACSLMAVCEAAVAGDPELFRVKKFDAAMIAEAVNHYVAVGEERTKAELEALSPNDLFSPEMKAGMLSN… |
| A0A1P8WB39 | 201-390 | None |
| A0A7W1JNG8 | 117-296 | None |
| A0A535AVV3 | 3-190 | None |
| A0A1F5RFJ3 | 15-195 | None |
| A0A7W0Y642 | 121-311 | None |
| A0A2E3MPZ0 | 332-513 | None |
| A0A4Q3W079 | 113-324 | None |
| A0A7W9W5N5 | 7-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.