DPCstruct | MC9989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 95 ± 3 aa |
| Standard deviation of domain lengths | 2.53 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I5D2R4 | 3-99 | MQRVYLPCVFIVGICALVIAKTGYVRSYLDDEVQTTFFIKRHPTLIMEFYDPFANEGDDKSIDQLSISERSRFAEYCKYRLGIDNNS… |
| A0A7W9Z3L6 | 1-98 | MKRIVILTSVTLSAVVFWAFVGAERVVGDHEEGVSWPLFVKHEPTFQFHFHNPAQRVLDIDPFDELSPTEQANFHEFCKIRYGKVSI… |
| A0A542JGT0 | 1-92 | None |
| A0A075K6R0 | 4-103 | None |
| A0A6I6H6V9 | 2-93 | None |
| A0A366E9R6 | 1-94 | None |
| A0A495SQK4 | 10-101 | None |
| A0A2T5ZC77 | 1-93 | None |
| A0A7W9Z6F1 | 76-170 | None |
| A0A0G3BHF0 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.