DPCstruct | MC9988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6MD78 | 2-79 | MTDRIKIIKINGEEHSDLKASIQDKSIYLMQSNVLIESNDLIQRSMSNGGEETFKVIDPGYNEKFHTIPAHYQMKVQK |
| A0A139CDL8 | 1-85 | MPTETPYNDTLFIEKGSGERLGPLHGTVEADRVIVEAIHEIASGDVLIHRRSDQSDTRLTVTEPGFQPEIGDVPAHYAALVTRAE |
| A1VKG5 | 172-250 | None |
| A0A2S9TM14 | 6-92 | None |
| A0A808X0I7 | 1-89 | None |
| A0A377FAE7 | 1-96 | None |
| A0A840WMS9 | 1-86 | None |
| A0A841JNL8 | 240-320 | None |
| A0A078BCK5 | 1-96 | None |
| A0A853S9Q1 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.