DPCstruct | MC9987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8BM88 | 52-148 | KFEAFGVLVWSRYGQASEIAEMLAFVRDVAWEGLESVLEEVFYDSKASICTFVFAPKFDLKDSRASRVFLCAKKYISQFMWGDDVYN… |
| A0A139C221 | 1-109 | MTQEHGYFDPQSRQVEPGELRAFGVTIHSRRGRAGELCEMLRFVQDAATLGAAEHLKRVHFDSDSGVCHIDVDDRAPLHGSVEHRLN… |
| A0A139DER8 | 5-92 | None |
| A0A318BAL8 | 81-213 | None |
| A0A6S6ZV72 | 99-201 | None |
| A0A7R6R444 | 3-89 | None |
| A0A238D725 | 39-135 | None |
| A0A7K1QJV0 | 237-365 | None |
| A0A0Q6MJM1 | 1-92 | None |
| A0A1Y0N7X8 | 18-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.