DPCstruct | MC9985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 154 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 67.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 77.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YX10 | 302-452 | IGVSLVLRHALDKCRESPPDDWPAPAYVLVGREDLATAKMGSARKETGFGNNDNLTSISVPYMLHLQPVTVPTASDVPTSEVLNSED… |
| A0A1U8E2S5 | 1-171 | MVGERVGLQQLDLLPAGVSLPLRDALDKCRDSPPLDWPAASYVLLGREDLAFSCLAYSRKSVELEPHLSVNMTCMSTSYMLNLHPVT… |
| A0A287FU18 | 145-295 | None |
| A0A287FTX9 | 412-563 | None |
| A0A287FTZ3 | 311-461 | None |
| A0A446J095 | 71-221 | None |
| A0A1D6M2K7 | 753-904 | None |
| A0A452YWZ7 | 308-458 | None |
| A0A835V2D5 | 243-397 | None |
| A0A6P5EKT8 | 228-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.