DPCstruct | MC9984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 83.90 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0023- PF16880 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287XKV9 | 332-395 | YPGAHIGPEPTTDRFVVVMSGPDERTIPGNTLAVQADMPFSGLTTFGTSFLSKFECSQMPHPLL |
| A0A287E263 | 263-323 | GAHIGPEPTTDRFVVVMSGSDERTVPGNTIAVQADMPFNGLTTFGGAFLSKFECSQMPHPV |
| A0A4S4DLN0 | 141-192 | None |
| A0A453NE11 | 158-218 | None |
| A0A287E245 | 165-227 | None |
| A0A811QED2 | 209-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.