DPCstruct | MC9982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 4.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 70.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453I0R5 | 45-104 | MGNLFCSDHFIHRRFDLKGSSLGRTTDKPQTEIDEYTILKDLDLNFIFRLQKHWYQEFQR |
| A0A444FY83 | 9-59 | HPIHRRFDLKGSSHGRMTDKPEAEIDGTTTLKDLDLNLIFRLQSSWFQEFH |
| A0A453I0Y9 | 41-100 | None |
| A0A4S8J3X1 | 1-60 | None |
| A0A445FTA0 | 542-591 | None |
| A0A4Y1QUX7 | 43-93 | None |
| A0A6V7PQ92 | 258-309 | None |
| A0A287Q6C2 | 39-98 | None |
| A0A5N5HM90 | 84-149 | None |
| A0A5A7SWQ5 | 48-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.