DPCstruct | MC998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4CWZ0 | 2-111 | ETSDVAEYAHKLRLAIEERGAAALERDDWAVRFRELGFEMDCGHSYEELYGLALYDARGLRRELAHIDDVQTLGNAVFSQCRYITHW… |
| A0A415EMD4 | 7-123 | RKDIHKFAKKYLILYKDPMTPIDVVEESVFGEECTALGFKADQGKGFSKAYSKGAYQDWETLEQVIFQIEDPLLLGSGIYSRWLQVT… |
| A0A1C6CL43 | 2-119 | None |
| A0A1G6KPZ7 | 14-129 | None |
| A0A7X6HUX5 | 3-118 | None |
| G1WJN3 | 17-140 | None |
| A0A1Y4CLF6 | 2-111 | None |
| E0S4Y0 | 1-119 | None |
| A0A3N4G4U9 | 3-118 | None |
| A0A2K4ZH26 | 70-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.