DPCstruct | MC9979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6AS97 | 2-54 | NADDAYCIGCGCNDLNSCTGGCSWVRLDRNAHLGVCSECEHMVSDWDKGKRGF |
| A0A066ZMK0 | 11-74 | LENEPATCIGCGCNDFQACLDPKTGQGCSWLRVDHESGLGVCSVCEDHVDRWDEGERVPNHSVS |
| B2LS64 | 8-75 | None |
| A0A7R6P5A5 | 2-64 | None |
| A0A1D8JMP1 | 126-181 | None |
| A0A4R4CE62 | 3-64 | None |
| A0A522SHE0 | 1-60 | None |
| A0A377Z686 | 152-215 | None |
| A0A318L363 | 2-58 | None |
| A0A2N2AN37 | 9-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.