DPCstruct | MC9976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 358 ± 58 aa |
| Standard deviation of domain lengths | 57.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15296 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4BME6 | 510-861 | QLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVHQAESLLQEQRVTQGQKGGDPAQLLEILCSQLCPHGTQALSQGRE… |
| A0A1B6FQZ6 | 1-374 | MELEESFLSSQAPSFRATVEFVAERISSSCIKHICSNVIAPCKEEASTLYNKQKEENKKLSKQEVQTQVEEACQSTLARIHTALDDH… |
| G1QBL8 | 2-308 | None |
| V4CJA6 | 201-664 | None |
| S4REP1 | 1-294 | None |
| A0A4Y2DWL4 | 879-1166 | None |
| A0A067QR56 | 9-404 | None |
| A0A0L8HEC2 | 210-502 | None |
| A0A834RB97 | 744-1136 | None |
| A0A0C9RAX9 | 294-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.