DPCstruct | MC9975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 109 ± 26 aa |
| Standard deviation of domain lengths | 26.00 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3KZD4 | 94-176 | MRELSYKANDVLSKLFDDAGLILVDFKLEFGLFKGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEEVAHRLG |
| A0A1B6FMF4 | 65-163 | ITKDEVDVIKRVTVAVFEVLERAWASRNCALIDMKIEFGVSQQGEILIADVIDSDSWRLWPSGDKRLMKDKQVYRNLTNVTQADLDT… |
| A0A0G1IHF6 | 152-282 | None |
| A0A1V2LSE9 | 182-302 | None |
| A0A7N0V6R5 | 6-109 | None |
| A0A165Z984 | 90-189 | None |
| J6F825 | 438-557 | None |
| A0A0B3AHJ6 | 175-324 | None |
| A0A1U8FP48 | 387-497 | None |
| A0A496PN68 | 581-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.