DPCstruct | MC9972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7ZKW2 | 557-672 | LTNELKVGKAGFALRIDDSHLMHTGTFGISRKTYHATEWEQQYWETQLGILKDGSPVYKAGLNTTFAVYNKTFFNPHTFVDAVRVGG… |
| A0A4Y9IZI9 | 1-117 | MTVEKPFALKVGPSLSIDDIPDHFANKAEVIRHEQKFWEQRDGDKYRAPIDTTFALYRPLSGLNRSRAAEAYRLAPPYSLRHLPWYE… |
| L0DAD0 | 102-211 | None |
| A0A1G3YWS7 | 115-229 | None |
| A0A1H9YJP0 | 72-190 | None |
| A0A812KZ26 | 178-277 | None |
| A0A2N2Y908 | 62-177 | None |
| U2UL38 | 311-419 | None |
| A0A812GI81 | 172-294 | None |
| A0A1H3ZIB8 | 321-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.