DPCstruct | MC9971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 215 ± 11 aa |
| Standard deviation of domain lengths | 11.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6CD04 | 33-245 | LLISKNDAYTLAKEHLKNKPLTEIDIYRTVEMLPAHTKIISVGNEDIISPDCDSWLFFVDEMPLIANWEHPCKYIFVNAIGKVYVYE… |
| A0A4Y9IX56 | 27-247 | ISFDDAFEPVKSHFSDREEALFYLVEQSIDEDVWTFFVDLAPGFGWEHDCCLVEVSRFVDEEAIIEKITELRFPPKSKMTLISTNVD… |
| A0A7Y0THC6 | 10-212 | None |
| A0A399ICD2 | 6-231 | None |
| A0A147JWL1 | 54-260 | None |
| A0A0Q1B2V7 | 1-226 | None |
| A0A373IF03 | 21-216 | None |
| A0A2N2KVD3 | 1-228 | None |
| A0A1Y1RDY4 | 1-223 | None |
| A0A5D0SLJ7 | 31-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.