DPCstruct | MC9970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 225 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8TCW5 | 1-233 | MQISVLFNFTESVIPPRCRKPRTVTRNDGKVEVDIAVLSADQAPVAIRASGTFLSRDLAYAYELRWWEGQLWSPVSLDQSGEPRGRT… |
| A0A4Y9IWC6 | 1-216 | MVIEIEIEFHENEVPPRCRKPRPIGHKEKVKVRIREASATEAPVAFIVHSLRERMMEVRLFKNQLYKEARISFYNGKRSEEYEFDAI… |
| A0A3C0N3Q7 | 19-228 | None |
| A0A1P9YEU8 | 4-210 | None |
| A0A1Q6RVX0 | 1-225 | None |
| A0A066ZQZ6 | 1-253 | None |
| A0A6J5CD62 | 78-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.