DPCstruct | MC997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 17.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7IIR0 | 7-181 | KLVSWTGLALAVVLLIAGGLLTWASVFIGGEVDKQLSDQQIVMPVQEAIAGDEALSDADRDALEEFAGSKMDTGAEAKAYADHYILA… |
| A0A2N0MFG7 | 3-151 | TLKRHLWVGALAFGLLFIVLGTLFMVIGLDAKDMIRTALADENVTTSADAVEYGVPAGVVVTDAKTAEAQAEVIKKHSFDRYGRYAD… |
| A0A1F9AAT0 | 18-155 | None |
| A0A536LQB5 | 12-174 | None |
| A0A843S2M5 | 2-139 | None |
| A0A7M3MQ94 | 2-121 | None |
| S0DDL0 | 2-162 | None |
| A0A1G6GNC4 | 4-138 | None |
| A0A1F2XW69 | 2-184 | None |
| C7R1A1 | 57-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.