DPCstruct | MC9968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177G7T0 | 94-189 | APLVFVGYGVHAPERGWDDFKGVDLKGKIAVFLINDPDFDAKPDEAVAGKFGGRAMTYYGRWTYKYEEAARRGAIGALIVHDTPGAA… |
| A0A2Z3GMN9 | 1-112 | MPSVTLTDSPLVFAGYGVVAPEYKWDDYAGLDCTGKPVVVLNDDPGNAGSDTTLFKGKALTLYSRADYKAEEAVRHGATGLLVIYDT… |
| A0A2V8IKI3 | 286-385 | None |
| F4PGV5 | 231-319 | None |
| A0A1Q7FIW4 | 88-190 | None |
| A0A2V8ZVK0 | 1-98 | None |
| L8HA61 | 414-502 | None |
| A9EHY1 | 51-155 | None |
| A0A2E7EHG6 | 157-250 | None |
| A0A1F5VGL7 | 174-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.