DPCstruct | MC9967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Standard deviation of domain lengths | 10.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532EE78 | 13-138 | GDQAYEFKHGRNLMADVWQGGTISRQFPQPVWQYLNGPVRPNGKRSRRDNIIGTWRTRLGKPGSKEEQRLTGLYFGRGGIYRINELR… |
| A0A2Z3GLY9 | 22-162 | TQYTFGIGGGLLAAGLGLLTLTGGHSTELTHPRNLLADVWSEKPASDVFPPSVWYLLTEPAFSNGGQTSLAHNARRRWEHYGQLAQP… |
| F0NY17 | 97-244 | None |
| A0A3N1JTD7 | 4-147 | None |
| A0A0K1QEC7 | 163-286 | None |
| A0A521UA46 | 217-344 | None |
| A0A533XQL8 | 145-273 | None |
| A0A136JRL4 | 101-225 | None |
| A0A327SA61 | 20-177 | None |
| A0A4Q3SWY2 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.