DPCstruct | MC9966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 14 aa |
| Standard deviation of domain lengths | 13.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C1CTT0 | 1-102 | MRDYIVATQTLGTSVNWEHRLDGAIDMDSETGAMTVSESFAQHVCDLSNWSISQGFADVFPELRGFVHEVEQETIPMSKADLDEFLQ… |
| H1VVS9 | 40-111 | NEEFQSVYSASLRLINWPCRPIDALVVDPQSGEMWLSDTFTAHAMRVENWRLNENFVRRYPELRGCVAVEGS |
| A0A438N3J6 | 714-784 | None |
| V9D5G1 | 292-388 | None |
| A0A2V1BH49 | 210-284 | None |
| C9SCY3 | 88-187 | None |
| A0A0G4M3J2 | 1-75 | None |
| A0A0G4LUD2 | 516-608 | None |
| A0A0D2H1W1 | 245-325 | None |
| A0A0S6X4X3 | 350-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.