DPCstruct | MC9964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094FVR4 | 3-124 | QRPGSVSICDYYTEERYGSASAGNQLKMMQSIVSLAFGGPGSIDSADVPKGLTGILNPGVHDGVAVDLLPFFNGSMASTNLNNQAVG… |
| A0A1C1C8I9 | 3-115 | FARVVGVLRPNDTTICDYYTPLILGKENTSANELELMALITHTFSRQLHHSYGIKVDGTVGPRTLQGHDINLLPYFTGGYVSSNDVG… |
| A0A2N6NE80 | 10-125 | None |
| A0A094H363 | 538-646 | None |
| R4XAU4 | 3-121 | None |
| T5AAR5 | 1-141 | None |
| A0A6A5QLH0 | 8-143 | None |
| R8BPY1 | 11-129 | None |
| A0A5N6JU67 | 1-123 | None |
| Q2GMT5 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.