DPCstruct | MC996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6QMY8 | 9-94 | DIREIEVDERFTIAKREMLITFVVQLAYTFLMLVVAYTLGKGDPSLYRFVKGMPEWWFWCLVITFGFLGLIYYLVRRVFKDIPIDP |
| A0A1V6A1G9 | 11-100 | YDFAEIEMDPRFLQCRKEMFISFSTWLAFTAISLAVAYGLGKGPVEEYKYILGLPQWWFAVIVVSVVFTFIVIFLSLFVFQDMELSD… |
| D4CS21 | 4-78 | None |
| A0A1K1LDG0 | 66-158 | None |
| A0A7J9X4T8 | 42-130 | None |
| Q72FX6 | 2-91 | None |
| A0A374X6Q2 | 73-175 | None |
| A0A127SNB2 | 2-89 | None |
| A0A2S5GBG9 | 3-90 | None |
| A0A1B1EBW8 | 5-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.