DPCstruct | MC9959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 967 |
|---|---|
| Mean domain length (aa) | 209 ± 46 aa |
| Standard deviation of domain lengths | 45.76 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.54 |
| Pfam Score | 88.22 |
| Assigned Pfam label(s) | CL0111- PF12496- CL0063- CL0214- CL0409 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4EV12 | 21-222 | KEVDDLMIRRFLRARDMDIEKASALFLKYLAWKKTVLPKGHIPESEIANDLSHNKVCMQGHDKKGRPILVIVGNRHNPSKGNPEEFK… |
| A0A7S1Y2B1 | 563-811 | HQQWAALSINQRSCVTNLKKRWERRYPNRKFPDAWYLRFAKCSPGRPYNPKTAYRTMRQMDRRYLTITMRQMERQLMTRTLFPCPGL… |
| A0A061QUB5 | 16-205 | None |
| A0A7S2MMM1 | 1-141 | None |
| A0A4V5NFP4 | 418-684 | None |
| A0A397FFA2 | 162-428 | None |
| A0A1R3J8Z4 | 370-544 | None |
| A0A2B4STX4 | 229-390 | None |
| A0A1D2NAT7 | 681-925 | None |
| E9G4P9 | 44-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.