DPCstruct | MC9958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 75.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N6SFC8 | 251-373 | LYGNRKFYWEEKDEYGVYRDDREFARDLDGHTIPVHTKDIRRLLERASRDEPAYICLPEHASSFTQTKLVPKIYTKDEINEMFYRVC… |
| A0A3N6SB18 | 231-349 | GTRKFYWEEKDDYGIYRDDQGYARDVDGHTIRVHNKDMRRLLERASKDEHNYICLPEHASSFTQTKLVPKIYTKDEINEMFYGICGE… |
| A0A3N6PTS3 | 2-101 | None |
| A0A3N6PRW8 | 427-537 | None |
| A0A3N6UEK8 | 65-179 | None |
| A0A3N6UE51 | 284-407 | None |
| A0A3N6QIT8 | 64-178 | None |
| A0A3N6S1N1 | 42-162 | None |
| A0A3N6RX38 | 5-123 | None |
| A0A3N6RK45 | 152-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.