DPCstruct | MC9957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 27 aa |
| Standard deviation of domain lengths | 27.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7KI35 | 113-278 | VPTITVTPGTAGGLISSNAQNGQYISQGEKILLDATPDKQDGATAFGGQDWDGAISAYQQAANSDPNDPEAKIYLNNAQAQKSGNPL… |
| A0A845Y0U0 | 1-161 | MIVVSLIGFAYLSLRVLKDLIIVTDPVVPKPEICPLKMDDHISCGEESLFHDLPPLNKKYAMKYYHDKRYDKASRFFEISFQQESQD… |
| A0A3N6RIA9 | 153-372 | None |
| K9PGS7 | 439-657 | None |
| T2J7J5 | 230-459 | None |
| A0A856MD78 | 1-217 | None |
| D6U5Y8 | 90-301 | None |
| A0A846G787 | 382-630 | None |
| A0A846CBK8 | 14-221 | None |
| A0A401II84 | 188-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.