DPCstruct | MC9951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 258 |
|---|---|
| Mean domain length (aa) | 146 ± 30 aa |
| Standard deviation of domain lengths | 29.84 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.83 |
| Pfam Score | 87.08 |
| Assigned Pfam label(s) | PF07009- PF11942- CL0439- PF00687- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2EYG3 | 3-166 | QHWYVVQTQTNFEDKAKTELERLMKSPEYAEKIVEVIVPTEEVIKISKNKKTVNKRKFFPGYVMVKMDLDEDTYWAVRKISGVKSFL… |
| A0A1T4MKZ2 | 1-84 | MEYYCLMVRTGEEEEFKKKARKAFCEQACTAELYYFQRTLKTNQGKLYEKPLFPGYLFFQTESLTPQIMQTLKKIDGFIRILLV |
| A0A2S2CKL9 | 26-148 | None |
| O67757 | 124-248 | None |
| R7UA90 | 10-181 | None |
| A0A6A5DNY6 | 164-317 | None |
| A0A2N2MEM4 | 33-163 | None |
| A0A177VIK5 | 173-336 | None |
| A0A246FK25 | 7-137 | None |
| A0A365VRW8 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.