DPCstruct | MC995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 244 ± 46 aa |
| Standard deviation of domain lengths | 46.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848WKI2 | 124-324 | EETDSKLNEDGVVRRRQVISQMRAAVAATKADRAVTRLISVEDQDEVEKKAYRNDLSDAVSETKPLPEHTSDRKPSGPPLVLVSSQR… |
| A0A2D5CQU0 | 8-308 | LPRDGPSQNRPSNVVNTSDTASRVSATNKTTTDPSPLPSKDDAEDRYQKGQDSTQNRDKCQNIPAMSRLLDKTNNQMEAPENKTRRN… |
| A0A2N3BJL5 | 528-834 | None |
| A0A0T5PF44 | 486-771 | None |
| A0A0P7WVT6 | 105-329 | None |
| A0A481PJG2 | 219-431 | None |
| A0A2U2C4E6 | 803-1028 | None |
| A0A258EKF9 | 309-665 | None |
| A0A0P1ERZ9 | 3-238 | None |
| A0A350LWQ6 | 430-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.