DPCstruct | MC9948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 163 ± 30 aa |
| Standard deviation of domain lengths | 30.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238ZXG0 | 22-160 | EESKKDMFKKNLEKIKQVLEGTNFKTEEEKSRYENKLNEKIKSGEKLSQSEMSYIQRTNPIMYMRIKRVQMQREMLERKLKQCKSKK… |
| A0A1V2YGC2 | 25-195 | GHMSGTKVQNTLGPDQQQAIDKQATDKHEIQYTPRDDFKATEESSKVQEVYSKIMSGQEVTPEEKELLKNAAPDLYQKVALVEQERE… |
| A0A1G8FI14 | 2-99 | None |
| A0A4S2A7S3 | 1-169 | None |
| A0A7X5CDB5 | 14-198 | None |
| A0A1Q6UKT1 | 32-174 | None |
| A0A1Y4I1I3 | 7-224 | None |
| A0A845SN41 | 5-222 | None |
| A0A7C9LBG2 | 26-215 | None |
| A0A349IMJ8 | 69-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.